PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g032170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family MIKC_MADS
Protein Properties Length: 210aa    MW: 24138.7 Da    PI: 9.3698
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g032170.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF79.91.7e-25958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien  nr vtfskRrng+ KKA+E+ vLCda+va+iif+s+gk+ +y+
  Csa20g032170.1  9 KRIENANNRVVTFSKRRNGLVKKAKEITVLCDAKVALIIFASNGKMTDYC 58
                    79*********************************************997 PP

2K-box71.62.4e-2471170199
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqie.elqkkekelqeenkaL 94 
                     yqk sgk+l++ak+e+l++e++++kke+++Lq e+Rhl+Ged++sL+lk+L+ +e+++e++l k+R+++  + l   + + ++  +e+++ + +L
  Csa20g032170.1  71 YQKLSGKKLWDAKHENLSNEIDRIKKENDSLQLELRHLKGEDIQSLNLKNLMAVEHAIEHGLDKVRDHQACVHLYVRSyTXKMIVEENRQLHFQL 165
                     899******************************************************************98765555515677789999999999 PP

           K-box  95 rkkle 99 
                     +++ +
  Csa20g032170.1 166 QQQEM 170
                     99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.375161IPR002100Transcription factor, MADS-box
SMARTSM004326.6E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.33E-34296IPR002100Transcription factor, MADS-box
CDDcd002655.24E-38280No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-26323IPR002100Transcription factor, MADS-box
PfamPF003197.7E-221057IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-263859IPR002100Transcription factor, MADS-box
PfamPF014869.1E-1582165IPR002487Transcription factor, K-box
PROSITE profilePS5129712.69384171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MGRGKIEIKR IENANNRVVT FSKRRNGLVK KAKEITVLCD AKVALIIFAS NGKMTDYCCP  60
SMDLGAMLDQ YQKLSGKKLW DAKHENLSNE IDRIKKENDS LQLELRHLKG EDIQSLNLKN  120
LMAVEHAIEH GLDKVRDHQA CVHLYVRSYT XKMIVEENRQ LHFQLQQQEM AIASNARGLM  180
MRYHDGQFGY RVQPIQPNLQ EKIMSLVID*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D9e-16263162Myocyte-specific enhancer factor 2A
3mu6_C9e-16263162Myocyte-specific enhancer factor 2A
3mu6_B9e-16263162Myocyte-specific enhancer factor 2A
3mu6_A9e-16263162Myocyte-specific enhancer factor 2A
1egw_D1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-15263162MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-15289180Myocyte-specific enhancer factor 2A
3p57_I1e-15289180Myocyte-specific enhancer factor 2A
3p57_D1e-15289180Myocyte-specific enhancer factor 2A
3p57_C1e-15289180Myocyte-specific enhancer factor 2A
3p57_B1e-15289180Myocyte-specific enhancer factor 2A
3p57_A1e-15289180Myocyte-specific enhancer factor 2A
3kov_J1e-15289180Myocyte-specific enhancer factor 2A
3kov_I1e-15289180Myocyte-specific enhancer factor 2A
3kov_B1e-15289180Myocyte-specific enhancer factor 2A
3kov_A1e-15289180Myocyte-specific enhancer factor 2A
1tqe_S1e-15163163Myocyte-specific enhancer factor 2B
1tqe_R1e-15163163Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU5517630.0EU551763.1 Capsella bursa-pastoris PISTILLATA-like protein (PIb) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010420863.11e-142PREDICTED: floral homeotic protein PISTILLATA
SwissprotP480071e-139PIST_ARATH; Floral homeotic protein PISTILLATA
TrEMBLM4CQQ81e-139M4CQQ8_BRARP; Uncharacterized protein
STRINGBra006549.1-P1e-139(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53002751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.11e-140MIKC_MADS family protein